Lineage for d1gbla_ (1gbl A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins) 
Protein alpha-Lytic protease [50498] (1 species) Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (38 PDB entries) 
Domain d1gbla_: 1gbl A: [25794]
Details for d1gbla_
PDB Entry: 1gbl (more details), 2.15 Å
PDB Description: alpha-lytic protease with met 190 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
SCOP Domain Sequences for d1gbla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gbla_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacagrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg
SCOP Domain Coordinates for d1gbla_:
Click to download the PDB-style file with coordinates for d1gbla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gbla_:
- d1gbla_ appears in SCOP 1.57
- d1gbla_ appears in the current release, SCOPe 2.08
View in 3D