SCOPe 2.04: Domain d4maga_: 4mag A:

Lineage for d4maga_ (4mag A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (87 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:593588] [257929] (1 PDB entry)

8. Domain d4maga_: 4mag A: [257930]
   automated match to d4ovsa_
   complexed with co, so4

Details for d4maga_

PDB Entry: 4mag, 1.45 Å

PDB Description: Crystal structure of the Periplasmic Sialic Acid Binding Protein from Vibrio Cholerea

PDB Compounds: (A:) Sialic Acid Binding Protein

SCOPe Domain Sequences for d4maga_:

Sequence; same for both SEQRES and ATOM records:

>d4maga_ c.94.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 593588]}
attlkmgmqasvgsveynsakmladtleemsqgeiklalypsaqlgddramlqqltlgdl
dityaefgrmglwipraeavmlpyvakdfdhlrrmfesdfgqgvrdemlqkfnwraldtw
yngtrettsnrplnsiedfkglklrvpnakqnlnyaklsgasptpmsfsevylalqtnav
dgqenplptiktmkfyevqknlamthhivndqmviisestwqklsdtdkdiiqkavqkvg
dahtqtvktqeaelvsffkseginvtypdlepfreamqplykefdsnigqpivsklaaml
qhhhhhh

Timeline for d4maga_:

• d4maga_ is new in SCOPe 2.04-stable
  
• d4maga_ appears in SCOPe 2.05
  
• d4maga_ appears in the current release, SCOPe 2.08, called d4maga1