SCOPe 2.06: Domain d4lwyl_: 4lwy L:

Lineage for d4lwyl_ (4lwy L:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries)
   Uniprot P02954

8. Domain d4lwyl_: 4lwy L: [257906]
   Other proteins in same PDB: d4lwyh1, d4lwyh2, d4lwym_
   automated match to d3v3yl_
   complexed with bcl, bph, cdl, dio, edo, fe, k, lda, po4, spn, trs, u10, unl; mutant

Details for d4lwyl_

PDB Entry: 4lwy, 2.9 Å

PDB Description: L(M196)H,H(M202)L Double Mutant Structure of Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d4lwyl_:

Sequence; same for both SEQRES and ATOM records:

>d4lwyl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaitff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d4lwyl_:

• d4lwyl_ first appeared in SCOPe 2.04
  
• d4lwyl_ appears in SCOPe 2.05
  
• d4lwyl_ appears in SCOPe 2.07
  
• d4lwyl_ appears in the current release, SCOPe 2.08