SCOPe 2.07: Domain d4lv3b_: 4lv3 B:

Lineage for d4lv3b_ (4lv3 B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries)

8. Domain d4lv3b_: 4lv3 B: [257902]
   automated match to d1my8a_
   complexed with 25n, po4

Details for d4lv3b_

PDB Entry: 4lv3, 1.42 Å

PDB Description: AmpC beta-lactamase in complex with (3,5-di-tert-butylphenyl) boronic acid

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d4lv3b_:

Sequence; same for both SEQRES and ATOM records:

>d4lv3b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d4lv3b_:

• d4lv3b_ first appeared in SCOPe 2.04
  
• d4lv3b_ appears in SCOPe 2.06
  
• d4lv3b_ appears in the current release, SCOPe 2.08