SCOPe 2.04: Domain d4lv1a_: 4lv1 A:

Lineage for d4lv1a_ (4lv1 A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (95 PDB entries)

8. Domain d4lv1a_: 4lv1 A: [257898]
   automated match to d1my8a_
   complexed with nl9, po4

Details for d4lv1a_

PDB Entry: 4lv1, 1.74 Å

PDB Description: AmpC beta-lactamase in complex with [1-(3-chlorophenyl)-1H-pyrazol-4-yl] boronic acid

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4lv1a_:

Sequence; same for both SEQRES and ATOM records:

>d4lv1a_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d4lv1a_:

• d4lv1a_ is new in SCOPe 2.04-stable
  
• d4lv1a_ appears in SCOPe 2.05
  
• d4lv1a_ appears in the current release, SCOPe 2.08