Lineage for d2lu9a_ (2lu9 A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1700854Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 1700969Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 1701094Protein automated matches [197331] (4 species)
    not a true protein
  7. 1701101Species Mesobuthus tamulus [TaxId:34647] [255376] (7 PDB entries)
  8. 1701102Domain d2lu9a_: 2lu9 A: [257891]
    automated match to d1scya_

Details for d2lu9a_

PDB Entry: 2lu9 (more details)

PDB Description: NMR solution structure of recombinant Tamapin
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 5.4

SCOPe Domain Sequences for d2lu9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lu9a_ g.3.7.2 (A:) automated matches {Mesobuthus tamulus [TaxId: 34647]}
afcnlrrcelscrslgllgkcigeeckcvpy

SCOPe Domain Coordinates for d2lu9a_:

Click to download the PDB-style file with coordinates for d2lu9a_.
(The format of our PDB-style files is described here.)

Timeline for d2lu9a_: