SCOPe 2.08: Domain d4lrib1: 4lri B:1-111

Lineage for d4lrib1 (4lri B:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4lrib1: 4lri B:1-111 [257880]
   Other proteins in same PDB: d4lria2, d4lrib2, d4lric_, d4lrip_
   automated match to d1dn0a1

Details for d4lrib1

PDB Entry: 4lri, 1.65 Å

PDB Description: Anti CMV Fab Fragment

PDB Compounds: (B:) MSL-109 Light Chain

SCOPe Domain Sequences for d4lrib1:

Sequence; same for both SEQRES and ATOM records:

>d4lrib1 b.1.1.0 (B:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslsvtpgepasiscrssqsllhtngynyldwyvqkpgqspqlliylasnra
sgvpdrfsgsgsgtdftlkisrvetedvgvyycmqalqiprtfgqgtkvei

Timeline for d4lrib1:

• d4lrib1 first appeared in SCOPe 2.04
  
• d4lrib1 appears in SCOPe 2.07