Lineage for d4ltcf_ (4ltc F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (108 PDB entries)
  8. 2554896Domain d4ltcf_: 4ltc F: [257866]
    Other proteins in same PDB: d4ltca_, d4ltcb_, d4ltcc_, d4ltcd_, d4ltce_, d4ltcg_, d4ltch_, d4ltci_, d4ltcj_, d4ltck_, d4ltcl_, d4ltcm_, d4ltcn_, d4ltco_, d4ltcp_, d4ltcq_, d4ltcr_, d4ltcs_, d4ltcu_, d4ltcv_, d4ltcw_, d4ltcx_, d4ltcy_, d4ltcz_
    automated match to d1irug_
    complexed with ec6

Details for d4ltcf_

PDB Entry: 4ltc (more details), 2.5 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with enone carmaphycin analogue 6
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4ltcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ltcf_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d4ltcf_:

Click to download the PDB-style file with coordinates for d4ltcf_.
(The format of our PDB-style files is described here.)

Timeline for d4ltcf_: