Lineage for d4ltcd_ (4ltc D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2228770Domain d4ltcd_: 4ltc D: [257864]
    Other proteins in same PDB: d4ltca_, d4ltce_, d4ltcf_, d4ltcg_, d4ltci_, d4ltcj_, d4ltck_, d4ltcl_, d4ltcm_, d4ltcn_, d4ltco_, d4ltcs_, d4ltct_, d4ltcu_, d4ltcw_, d4ltcx_, d4ltcy_, d4ltcz_
    automated match to d1rype_
    complexed with ec6

Details for d4ltcd_

PDB Entry: 4ltc (more details), 2.5 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with enone carmaphycin analogue 6
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d4ltcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ltcd_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d4ltcd_:

Click to download the PDB-style file with coordinates for d4ltcd_.
(The format of our PDB-style files is described here.)

Timeline for d4ltcd_: