SCOPe 2.04: Domain d4lqha_: 4lqh A:

Lineage for d4lqha_ (4lqh A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein (Apo)ferritin [47246] (8 species)

7. Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (17 PDB entries)

8. Domain d4lqha_: 4lqh A: [257856]
   automated match to d1mfra_
   complexed with cl, mg

Details for d4lqha_

PDB Entry: 4lqh, 1.16 Å

PDB Description: high resolution structure of native frog m ferritin

PDB Compounds: (A:) Ferritin, middle subunit

SCOPe Domain Sequences for d4lqha_:

Sequence; same for both SEQRES and ATOM records:

>d4lqha_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes

Timeline for d4lqha_:

• d4lqha_ is new in SCOPe 2.04-stable
  
• d4lqha_ appears in SCOPe 2.05
  
• d4lqha_ appears in the current release, SCOPe 2.08