Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (24 species) not a true protein |
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries) |
Domain d4lpma_: 4lpm A: [257851] automated match to d3ka3a_ complexed with cl, mg; mutant |
PDB Entry: 4lpm (more details), 1.65 Å
SCOPe Domain Sequences for d4lpma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpma_ a.25.1.1 (A:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]} vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk vdphlcefleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes
Timeline for d4lpma_: