Lineage for d4lhgx_ (4lhg X:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621089Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1621090Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1621091Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1621194Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 1621201Species Haemophilus influenzae [TaxId:727] [142746] (4 PDB entries)
    Uniprot P45040 2-311
  8. 1621204Domain d4lhgx_: 4lhg X: [257836]
    automated match to d1y7la1
    complexed with gol, pda

Details for d4lhgx_

PDB Entry: 4lhg (more details), 1.98 Å

PDB Description: crystal structure of o-acetylserine sulfhydrylase from haemophilus influenzae in complex with reaction intermediate alpha-aminoacrylate
PDB Compounds: (X:) Cysteine synthase

SCOPe Domain Sequences for d4lhgx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhgx_ c.79.1.1 (X:) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]}
aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgmk
gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
serylstalfeg

SCOPe Domain Coordinates for d4lhgx_:

Click to download the PDB-style file with coordinates for d4lhgx_.
(The format of our PDB-style files is described here.)

Timeline for d4lhgx_: