SCOPe 2.04: Domain d4lftb_: 4lft B:

Lineage for d4lftb_ (4lft B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein automated matches [190676] (7 species)
   not a true protein

7. Species Dendroaspis polylepis [TaxId:8620] [257019] (1 PDB entry)

8. Domain d4lftb_: 4lft B: [257834]
   automated match to d1txba_

Details for d4lftb_

PDB Entry: 4lft, 1.7 Å

PDB Description: structure of alpha-elapitoxin-dpp2d isolated from black mamba (dendroaspis polylepis) venom

PDB Compounds: (B:) Alpha-elapitoxin-Dpp2a

SCOPe Domain Sequences for d4lftb_:

Sequence; same for both SEQRES and ATOM records:

>d4lftb_ g.7.1.1 (B:) automated matches {Dendroaspis polylepis [TaxId: 8620]}
rtcnktfsdqskicppgenicytktwcdafcsqrgkrvelgcaatcpkvkagveikccst
dncnkfqfgkpr

Timeline for d4lftb_:

• d4lftb_ is new in SCOPe 2.04-stable
  
• d4lftb_ appears in SCOPe 2.05
  
• d4lftb_ appears in the current release, SCOPe 2.08