Lineage for d4le2b_ (4le2 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1587002Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1587003Protein automated matches [190131] (54 species)
    not a true protein
  7. 1587015Species Bacillus subtilis [TaxId:224308] [257830] (1 PDB entry)
  8. 1587017Domain d4le2b_: 4le2 B: [257832]
    automated match to d3t8ya_
    complexed with k, po4

Details for d4le2b_

PDB Entry: 4le2 (more details), 2.54 Å

PDB Description: crystal structure of the unphosphorylated receiver domain of desr in the active state
PDB Compounds: (B:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d4le2b_:

Sequence, based on SEQRES records: (download)

>d4le2b_ c.23.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
gsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiemp
gktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmn
gkriyapelmed

Sequence, based on observed residues (ATOM records): (download)

>d4le2b_ c.23.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
gsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiemp
gktgleaaeelkdtgckiiilttfpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmed

SCOPe Domain Coordinates for d4le2b_:

Click to download the PDB-style file with coordinates for d4le2b_.
(The format of our PDB-style files is described here.)

Timeline for d4le2b_:

  • d4le2b_ appears in periodic updates to SCOPe 2.04 starting on 2014-07-31
  • d4le2b_ appears in SCOPe 2.05
  • d4le2b_ appears in the current release, SCOPe 2.07, called d4le2b1