SCOPe 2.04: Domain d4ldka_: 4ldk A:

Lineage for d4ldka_ (4ldk A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)

6. Protein Augmenter of liver regeneration [89018] (2 species)
   a mammalian FAD-dependent sulfhydryl oxidase

7. Species Human (Homo sapiens) [TaxId:9606] [189907] (7 PDB entries)

8. Domain d4ldka_: 4ldk A: [257829]
   automated match to d3tk0a_
   complexed with fad, na; mutant

Details for d4ldka_

PDB Entry: 4ldk, 2.04 Å

PDB Description: FAD-linked sulfhydryl oxidase ALR mutation

PDB Compounds: (A:) FAD-linked sulfhydryl oxidase ALR

SCOPe Domain Sequences for d4ldka_:

Sequence; same for both SEQRES and ATOM records:

>d4ldka_ a.24.15.1 (A:) Augmenter of liver regeneration {Human (Homo sapiens) [TaxId: 9606]}
fredcppdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskfypaeecaedlr
krlarnhpdtrtraaftqwlchlhnevnrklgkpdfdcskvderwrdgwkdgscd

Timeline for d4ldka_:

• d4ldka_ is new in SCOPe 2.04-stable
  
• d4ldka_ appears in SCOPe 2.05
  
• d4ldka_ appears in the current release, SCOPe 2.08