SCOPe 2.07: Domain d4kzel1: 4kze L:1-108

Lineage for d4kzel1 (4kze L:1-108)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d4kzel1: 4kze L:1-108 [257825]
   Other proteins in same PDB: d4kzel2
   automated match to d3pgfl1
   protein/RNA complex; complexed with k, mg

Details for d4kzel1

PDB Entry: 4kze, 2.4 Å

PDB Description: Crystal structure of an RNA aptamer in complex with Fab

PDB Compounds: (L:) BL3-6 Fab antibody, light chain

SCOPe Domain Sequences for d4kzel1:

Sequence; same for both SEQRES and ATOM records:

>d4kzel1 b.1.1.0 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
srfsgsrsgtdftltisslqpedfatyycqqsysfpstfgqgtkveik

Timeline for d4kzel1:

• d4kzel1 first appeared in SCOPe 2.04
  
• d4kzel1 appears in SCOPe 2.06
  
• d4kzel1 appears in the current release, SCOPe 2.08