Lineage for d3proa_ (3pro A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465073Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins)
  6. 465078Protein alpha-Lytic protease [50498] (1 species)
  7. 465079Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (39 PDB entries)
  8. 465093Domain d3proa_: 3pro A: [25780]
    Other proteins in same PDB: d3proc1, d3proc2, d3prod1, d3prod2

Details for d3proa_

PDB Entry: 3pro (more details), 1.8 Å

PDB Description: alpha-lytic protease complexed with c-terminal truncated pro region

SCOP Domain Sequences for d3proa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3proa_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOP Domain Coordinates for d3proa_:

Click to download the PDB-style file with coordinates for d3proa_.
(The format of our PDB-style files is described here.)

Timeline for d3proa_: