SCOPe 2.04: Domain d4k7ib_: 4k7i B:

Lineage for d4k7ib_ (4k7i B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries)

8. Domain d4k7ib_: 4k7i B: [257799]
   automated match to d3umac_
   complexed with caq, dms

Details for d4k7ib_

PDB Entry: 4k7i, 2.25 Å

PDB Description: human peroxiredoxin 5 with a fragment

PDB Compounds: (B:) Peroxiredoxin-5, mitochondrial

SCOPe Domain Sequences for d4k7ib_:

Sequence; same for both SEQRES and ATOM records:

>d4k7ib_ c.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

Timeline for d4k7ib_:

• d4k7ib_ is new in SCOPe 2.04-stable
  
• d4k7ib_ appears in SCOPe 2.05
  
• d4k7ib_ appears in the current release, SCOPe 2.08