Lineage for d4ha2a_ (4ha2 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062237Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
    automatically mapped to Pfam PF00197
  6. 2062274Protein automated matches [190504] (2 species)
    not a true protein
  7. 2062277Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (12 PDB entries)
  8. 2062295Domain d4ha2a_: 4ha2 A: [257779]
    automated match to d2wbca_
    complexed with ni; mutant

Details for d4ha2a_

PDB Entry: 4ha2 (more details), 2.9 Å

PDB Description: Crystal structure ofa phenyl alanine 91 mutant of WCI
PDB Compounds: (A:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d4ha2a_:

Sequence, based on SEQRES records: (download)

>d4ha2a_ b.42.4.1 (A:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
ddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiris
sqflslfiprgslvalgfanppscaaspwftvvdspqgpavklsqqklpekdalvfkfek
vshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks

Sequence, based on observed residues (ATOM records): (download)

>d4ha2a_ b.42.4.1 (A:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
ddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiris
sqflslfiprgslvalgfanppscaaspwftvvdspqgpavklsqqklpekdalvfkfek
vshsnihvykllycqhdevkcdqyigihrdrngnrrlvvteenplelvllkaks

SCOPe Domain Coordinates for d4ha2a_:

Click to download the PDB-style file with coordinates for d4ha2a_.
(The format of our PDB-style files is described here.)

Timeline for d4ha2a_: