SCOPe 2.08: Domain d4cywf_: 4cyw F:

Lineage for d4cywf_ (4cyw F:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries)

8. Domain d4cywf_: 4cyw F: [257767]
   Other proteins in same PDB: d4cywa_, d4cywc_, d4cywe_
   automated match to d3m5ib_
   complexed with nag

Details for d4cywf_

PDB Entry: 4cyw, 2.6 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin in complex with human receptor analog 6-sln

PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4cywf_:

Sequence; same for both SEQRES and ATOM records:

>d4cywf_ h.3.1.1 (F:) automated matches {Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni

Timeline for d4cywf_:

• d4cywf_ first appeared in SCOPe 2.04
  
• d4cywf_ appears in SCOPe 2.07