Lineage for d4cvqb_ (4cvq B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867534Species Escherichia coli [TaxId:83333] [257757] (5 PDB entries)
  8. 1867536Domain d4cvqb_: 4cvq B: [257759]
    automated match to d1xi9a_
    complexed with act, gol, plp

Details for d4cvqb_

PDB Entry: 4cvq (more details), 2.11 Å

PDB Description: crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution
PDB Compounds: (B:) glutamate-pyruvate aminotransferase alaa

SCOPe Domain Sequences for d4cvqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvqb_ c.67.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
spiekssklenvcydirgpvlkeakrleeegnkvlklnignpapfgfdapdeilvdvirn
lptaqgycdskglysarkaimqhyqargmrdvtvediyigngvselivqamqallnsgde
mlvpapdyplwtaavslssgkavhylcdessdwfpdlddirakitprtrgiviinpnnpt
gavyskellmeiveiarqhnliifadeiydkilyddaehhsiaplapdlltitfnglskt
yrvagfrqgwmvlngpkkhakgyieglemlasmrlcanvpaqhaiqtalggyqsisefit
pggrlyeqrnrawelindipgvscvkprgalymfpkidakrfnihddqkmvldfllqekv
llvqgtafnwpwpdhfrivtlprvddielslskfarflsgyhql

SCOPe Domain Coordinates for d4cvqb_:

Click to download the PDB-style file with coordinates for d4cvqb_.
(The format of our PDB-style files is described here.)

Timeline for d4cvqb_: