Lineage for d4cnzb_ (4cnz B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651257Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1651258Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 1651332Protein automated matches [190670] (6 species)
    not a true protein
  7. 1651333Species Azospirillum brasilense [TaxId:192] [189362] (4 PDB entries)
  8. 1651340Domain d4cnzb_: 4cnz B: [257746]
    automated match to d3mhya_
    complexed with adp

Details for d4cnzb_

PDB Entry: 4cnz (more details), 1.7 Å

PDB Description: structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine diphosphate
PDB Compounds: (B:) PII-like protein Pz

SCOPe Domain Sequences for d4cnzb_:

Sequence, based on SEQRES records: (download)

>d4cnzb_ d.58.5.1 (B:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgqteiyrgaeysvsflpkvk
vevavsddqyeqvveaiqkaantgrigdgkifvldiaqavrirtgetnteal

Sequence, based on observed residues (ATOM records): (download)

>d4cnzb_ d.58.5.1 (B:) automated matches {Azospirillum brasilense [TaxId: 192]}
mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgsflpkvkvevavsddqyeq
vveaiqkaantgrigdgkifvldiaqavrirtgetnteal

SCOPe Domain Coordinates for d4cnzb_:

Click to download the PDB-style file with coordinates for d4cnzb_.
(The format of our PDB-style files is described here.)

Timeline for d4cnzb_: