SCOPe 2.04: Domain d4c4ba_: 4c4b A:

Lineage for d4c4ba_ (4c4b A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
   automatically mapped to Pfam PF01880

6. Protein automated matches [190694] (3 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [237934] (4 PDB entries)

8. Domain d4c4ba_: 4c4b A: [257731]
   automated match to d4bfkb_
   complexed with edo, fe2

Details for d4c4ba_

PDB Entry: 4c4b, 2.5 Å

PDB Description: Superoxide reductase (Neelaredoxin) from Archaeoglobus fulgidus E12V in the reduced form

PDB Compounds: (A:) superoxide reductase

SCOPe Domain Sequences for d4c4ba_:

Sequence; same for both SEQRES and ATOM records:

>d4c4ba_ b.1.13.1 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
melfqtadwkkvkhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegs
kfpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgea
tlsle

Timeline for d4c4ba_:

• d4c4ba_ is new in SCOPe 2.04-stable
  
• d4c4ba_ appears in SCOPe 2.05
  
• d4c4ba_ appears in the current release, SCOPe 2.08