Lineage for d4byyb2 (4byy B:148-217)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480003Species Corynebacterium glutamicum [TaxId:1718] [226340] (2 PDB entries)
  8. 1480011Domain d4byyb2: 4byy B:148-217 [257729]
    Other proteins in same PDB: d4byya1, d4byyb1
    automated match to d3r6sc2
    complexed with gol, po4

Details for d4byyb2

PDB Entry: 4byy (more details), 2.48 Å

PDB Description: Apo GlxR
PDB Compounds: (B:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d4byyb2:

Sequence, based on SEQRES records: (download)

>d4byyb2 a.4.5.0 (B:148-217) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dvpgrvaktllqlanrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwi
rlegksvliv

Sequence, based on observed residues (ATOM records): (download)

>d4byyb2 a.4.5.0 (B:148-217) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dvpgrvaktllqlanrfltqeeiaqlvgasretvnkalatfahrgwirlegksvliv

SCOPe Domain Coordinates for d4byyb2:

Click to download the PDB-style file with coordinates for d4byyb2.
(The format of our PDB-style files is described here.)

Timeline for d4byyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4byyb1