Lineage for d4byya1 (4byy A:1-147)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1559475Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1559696Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 1559697Protein automated matches [226927] (10 species)
    not a true protein
  7. 1559708Species Corynebacterium glutamicum [TaxId:1718] [226339] (2 PDB entries)
  8. 1559715Domain d4byya1: 4byy A:1-147 [257728]
    Other proteins in same PDB: d4byya2, d4byyb2
    automated match to d3r6sa1
    complexed with gol, po4

Details for d4byya1

PDB Entry: 4byy (more details), 2.48 Å

PDB Description: Apo GlxR
PDB Compounds: (A:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d4byya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4byya1 b.82.3.0 (A:1-147) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
megvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvkl
arhapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhp
aiaeqllrvlarrlrrtnasladlift

SCOPe Domain Coordinates for d4byya1:

Click to download the PDB-style file with coordinates for d4byya1.
(The format of our PDB-style files is described here.)

Timeline for d4byya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4byya2