Lineage for d4btza_ (4btz A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539013Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2539023Protein Major tree pollen allergen [55963] (4 species)
  7. 2539034Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (23 PDB entries)
  8. 2539043Domain d4btza_: 4btz A: [257711]
    automated match to d4a87a_
    complexed with mpd

Details for d4btza_

PDB Entry: 4btz (more details), 1.47 Å

PDB Description: Crystal Structure of peroxinitrite treated Major Birch Pollen Allergen Bet v 1.0101 (isoform a)
PDB Compounds: (A:) major pollen allergen bet v 1-a

SCOPe Domain Sequences for d4btza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4btza_ d.129.3.1 (A:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

SCOPe Domain Coordinates for d4btza_:

Click to download the PDB-style file with coordinates for d4btza_.
(The format of our PDB-style files is described here.)

Timeline for d4btza_: