Lineage for d4btnb_ (4btn B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505877Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 1505878Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 1505879Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 1505886Protein automated matches [256548] (1 species)
    not a true protein
  7. 1505887Species Homo sapiens [TaxId:9606] [256549] (3 PDB entries)
  8. 1505891Domain d4btnb_: 4btn B: [257703]
    automated match to d1g8qa_
    complexed with po4

Details for d4btnb_

PDB Entry: 4btn (more details), 2.05 Å

PDB Description: Multiple LEL structures
PDB Compounds: (B:) CD81 antigen

SCOPe Domain Sequences for d4btnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4btnb_ a.135.1.1 (B:) automated matches {Homo sapiens [TaxId: 9606]}
nkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknnl
cpsgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d4btnb_:

Click to download the PDB-style file with coordinates for d4btnb_.
(The format of our PDB-style files is described here.)

Timeline for d4btnb_: