SCOPe 2.08: Domain d4topa2: 4top A:84-219

Lineage for d4topa2 (4top A:84-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries)

8. Domain d4topa2: 4top A:84-219 [257699]
   Other proteins in same PDB: d4topa1, d4topb1
   automated match to d2vo4a2
   complexed with gsh

Details for d4topa2

PDB Entry: 4top, 2.35 Å

PDB Description: glycine max glutathione transferase

PDB Compounds: (A:) 2,4-d inducible glutathione s-transferase

SCOPe Domain Sequences for d4topa2:

Sequence; same for both SEQRES and ATOM records:

>d4topa2 a.45.1.0 (A:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]}
llpsdpyqraqtrfwadyvdkkiydlgrkiwtskgeekeaakkefiealklleeqlgdkt
yfggdnlgfvdialvpfytwfkayetfgtlniesecpkfiawakrclqkesvakslpdqq
kvyefimdlrkklgie

Timeline for d4topa2:

• d4topa2 first appeared in SCOPe 2.04
  
• d4topa2 appears in SCOPe 2.07