Lineage for d4qgra_ (4qgr A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614417Species Brucella abortus [TaxId:359391] [257681] (1 PDB entry)
  8. 1614418Domain d4qgra_: 4qgr A: [257682]
    automated match to d3uwca_
    complexed with act, mg, plp

Details for d4qgra_

PDB Entry: 4qgr (more details), 1.75 Å

PDB Description: Crystal structure of a DegT DnrJ EryC1 StrS aminotransferase from Brucella abortus
PDB Compounds: (A:) DegT/DnrJ/EryC1/StrS aminotransferase

SCOPe Domain Sequences for d4qgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qgra_ c.67.1.0 (A:) automated matches {Brucella abortus [TaxId: 359391]}
hhhmqfidlgaqrarienrlnaaiskvvaegryilgpevaefekklgeylgvehviacan
gtdalqmplmtrgigpghavfvpsftfaataevvalvgaepvfvdvdpdsynmnveqlea
aiaatikegrlepkaiipvdlfglaasynritaiaereglfiiedaaqsiggkrdnvmcg
afghvgatsfypakplgcygdggamftndaeladtlrsvlfhgkgetqydnvriginsrl
dtiqaavlleklailedemeardriarrynealkdvvkvpelpagnrsawaqysiesenr
dglkaqlqaegipsviyyvkplhlqtaykhysvapgglpvseslpsrilslpmhpylsea
dqdkiigvirgfhgkk

SCOPe Domain Coordinates for d4qgra_:

Click to download the PDB-style file with coordinates for d4qgra_.
(The format of our PDB-style files is described here.)

Timeline for d4qgra_: