Lineage for d4qgra1 (4qgr A:1-373)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896831Species Brucella abortus [TaxId:359391] [257681] (1 PDB entry)
  8. 2896832Domain d4qgra1: 4qgr A:1-373 [257682]
    Other proteins in same PDB: d4qgra2, d4qgrb2
    automated match to d3uwca_
    complexed with act, mg, plp

Details for d4qgra1

PDB Entry: 4qgr (more details), 1.75 Å

PDB Description: Crystal structure of a DegT DnrJ EryC1 StrS aminotransferase from Brucella abortus
PDB Compounds: (A:) DegT/DnrJ/EryC1/StrS aminotransferase

SCOPe Domain Sequences for d4qgra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qgra1 c.67.1.0 (A:1-373) automated matches {Brucella abortus [TaxId: 359391]}
mqfidlgaqrarienrlnaaiskvvaegryilgpevaefekklgeylgvehviacangtd
alqmplmtrgigpghavfvpsftfaataevvalvgaepvfvdvdpdsynmnveqleaaia
atikegrlepkaiipvdlfglaasynritaiaereglfiiedaaqsiggkrdnvmcgafg
hvgatsfypakplgcygdggamftndaeladtlrsvlfhgkgetqydnvriginsrldti
qaavlleklailedemeardriarrynealkdvvkvpelpagnrsawaqysiesenrdgl
kaqlqaegipsviyyvkplhlqtaykhysvapgglpvseslpsrilslpmhpylseadqd
kiigvirgfhgkk

SCOPe Domain Coordinates for d4qgra1:

Click to download the PDB-style file with coordinates for d4qgra1.
(The format of our PDB-style files is described here.)

Timeline for d4qgra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qgra2