SCOPe 2.07: Domain d4qc1a1: 4qc1 A:2062-2165

Lineage for d4qc1a1 (4qc1 A:2062-2165)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d4qc1a1: 4qc1 A:2062-2165 [257653]
   Other proteins in same PDB: d4qc1a2, d4qc1b2
   automated match to d2e7oa_
   complexed with so4, zn

Details for d4qc1a1

PDB Entry: 4qc1, 1.99 Å

PDB Description: crystal structure of human baz2b bromodomain in complex with an acetylated histone 3 peptide (h3k14ac)

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d4qc1a1:

Sequence; same for both SEQRES and ATOM records:

>d4qc1a1 a.29.2.0 (A:2062-2165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstireklssgqypn
letfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtf

Timeline for d4qc1a1:

• d4qc1a1 first appeared in SCOPe 2.04, called d4qc1a_
  
• d4qc1a1 appears in SCOPe 2.06
  
• d4qc1a1 appears in the current release, SCOPe 2.08