SCOPe 2.05: Domain d4qbma_: 4qbm A:

Lineage for d4qbma_ (4qbm A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d4qbma_: 4qbm A: [257651]
   automated match to d2e7oa_
   complexed with edo

Details for d4qbma_

PDB Entry: 4qbm, 1.65 Å

PDB Description: crystal structure of human baz2a bromodomain in complex with a diacetylated histone 4 peptide (h4k16ack20ac)

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2A

SCOPe Domain Sequences for d4qbma_:

Sequence; same for both SEQRES and ATOM records:

>d4qbma_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
sseefaadallvfdncqtfneddsevgkaghimrrffesrweefyq

Timeline for d4qbma_:

• d4qbma_ first appeared in SCOPe 2.04
  
• d4qbma_ is called d4qbma1 in SCOPe 2.06
  
• d4qbma_ appears in the current release, SCOPe 2.08, called d4qbma1