SCOPe 2.08: Domain d4qaga_: 4qag A:

Lineage for d4qaga_ (4qag A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d4qaga_: 4qag A: [257642]
   automated match to d4je2a_
   protein/RNA complex; complexed with f95, mn

Details for d4qaga_

PDB Entry: 4qag, 1.71 Å

PDB Description: Structure of a dihydroxycoumarin active-site inhibitor in complex with the RNASE H domain of HIV-1 reverse transcriptase

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d4qaga_:

Sequence; same for both SEQRES and ATOM records:

>d4qaga_ c.55.3.1 (A:) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
lwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiyl
alqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgigg
neqvdklvsagir

Timeline for d4qaga_:

• d4qaga_ first appeared in SCOPe 2.04
  
• d4qaga_ appears in SCOPe 2.07