SCOPe 2.08: Domain d4q7ea_: 4q7e A:

Lineage for d4q7ea_ (4q7e A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Leptospira biflexa [TaxId:355278] [257624] (1 PDB entry)

8. Domain d4q7ea_: 4q7e A: [257625]
   automated match to d1j56a_
   complexed with gol, so4

Details for d4q7ea_

PDB Entry: 4q7e, 1.44 Å

PDB Description: Non-phosphorylated HemR Receiver Domain from Leptospira biflexa

PDB Compounds: (A:) Response regulator of a two component regulatory system

SCOPe Domain Sequences for d4q7ea_:

Sequence; same for both SEQRES and ATOM records:

>d4q7ea_ c.23.1.0 (A:) automated matches {Leptospira biflexa [TaxId: 355278]}
mkprillveddeglgetlkerleqdkyrvewaktiseaenlyrpnafdlvvldlrlpdgn
gfdlaemivkkekdlpflfltaqagaqerlrgfelgaaefipkpfhlkeflirlervisl
trphy

Timeline for d4q7ea_:

• d4q7ea_ first appeared in SCOPe 2.04
  
• d4q7ea_ appears in SCOPe 2.07