SCOPe 2.04: Domain d4q4la3: 4q4l A:361-476

Lineage for d4q4la3 (4q4l A:361-476)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (6 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [257614] (1 PDB entry)

8. Domain d4q4la3: 4q4l A:361-476 [257615]
   Other proteins in same PDB: d4q4la1, d4q4la2
   automated match to d1mabb1
   complexed with na

Details for d4q4la3

PDB Entry: 4q4l, 2.2 Å

PDB Description: Crystal structure of an ATP synthase subunit beta 1 (F1-B1) from Burkholderia thailandensis

PDB Compounds: (A:) ATP synthase subunit beta 1

SCOPe Domain Sequences for d4q4la3:

Sequence; same for both SEQRES and ATOM records:

>d4q4la3 a.69.1.0 (A:361-476) automated matches {Burkholderia thailandensis [TaxId: 271848]}
idpnvigeehysitrrvqqtlqrykelrdiiailgmdelspedklsvararkiqrflsqp
fhvaevftgspgkyvplketirgfkmivdgecdhlpeqafymvgtideafekakki

Timeline for d4q4la3:

• d4q4la3 is new in SCOPe 2.04-stable
  
• d4q4la3 appears in SCOPe 2.05
  
• d4q4la3 appears in the current release, SCOPe 2.08