SCOPe 2.06: Domain d4q0oa_: 4q0o A:

Lineage for d4q0oa_ (4q0o A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d4q0oa_: 4q0o A: [257595]
   automated match to d2yqda_
   protein/DNA complex; complexed with 2xc, k

Details for d4q0oa_

PDB Entry: 4q0o, 1.83 Å

PDB Description: Crystal Structure of the fifth bromodomain of Human Poly-bromodomain containing protein 1 (PB1) in complex with a hydroxyphenyl-propenone ligand

PDB Compounds: (A:) Protein polybromo-1

SCOPe Domain Sequences for d4q0oa_:

Sequence; same for both SEQRES and ATOM records:

>d4q0oa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmekirs
hmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdlegd

Timeline for d4q0oa_:

• d4q0oa_ first appeared in SCOPe 2.04
  
• d4q0oa_ appears in SCOPe 2.05
  
• d4q0oa_ appears in SCOPe 2.07
  
• d4q0oa_ appears in the current release, SCOPe 2.08