Lineage for d4q0ka_ (4q0k A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215232Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2215233Protein automated matches [190218] (22 species)
    not a true protein
  7. 2215377Species Medicago truncatula [TaxId:3880] [194255] (7 PDB entries)
  8. 2215378Domain d4q0ka_: 4q0k A: [257593]
    automated match to d2flhb_
    complexed with ga3, gol

Details for d4q0ka_

PDB Entry: 4q0k (more details), 1.34 Å

PDB Description: Crystal Structure of Phytohormone Binding Protein from Medicago truncatula in complex with gibberellic acid (GA3)
PDB Compounds: (A:) phytohormone binding protein mtphbp

SCOPe Domain Sequences for d4q0ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q0ka_ d.129.3.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
mikefntqttlnvglealwaaqskditlvvpkvlpnivkdvqviegdggvgtklifnflp
giapvnyqreviteydelshtiglqvveggylnqglsyykttfqfsaisenktlvnvkis
ydheselieekvkptktsestlfylgqlekflln

SCOPe Domain Coordinates for d4q0ka_:

Click to download the PDB-style file with coordinates for d4q0ka_.
(The format of our PDB-style files is described here.)

Timeline for d4q0ka_: