Lineage for d4py8a1 (4py8 A:11-334)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775911Domain d4py8a1: 4py8 A:11-334 [257585]
    Other proteins in same PDB: d4py8a2, d4py8b_, d4py8j1, d4py8j2
    automated match to d3gbna_
    complexed with mli, nag

Details for d4py8a1

PDB Entry: 4py8 (more details), 2.91 Å

PDB Description: crystal structure of fab 3.1 in complex with the 1918 influenza virus hemagglutinin
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4py8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4py8a1 b.19.1.2 (A:11-334) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnipsi

SCOPe Domain Coordinates for d4py8a1:

Click to download the PDB-style file with coordinates for d4py8a1.
(The format of our PDB-style files is described here.)

Timeline for d4py8a1: