SCOPe 2.05: Domain d4pv9b_: 4pv9 B:

Lineage for d4pv9b_ (4pv9 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries)
   Uniprot P01887

8. Domain d4pv9b_: 4pv9 B: [257568]
   Other proteins in same PDB: d4pv9a1, d4pv9a2, d4pv9c1, d4pv9c2
   automated match to d1lk2b_
   complexed with act, gol

Details for d4pv9b_

PDB Entry: 4pv9, 2 Å

PDB Description: crystal structure of h2kb-q600v complex

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d4pv9b_:

Sequence; same for both SEQRES and ATOM records:

>d4pv9b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d4pv9b_:

• d4pv9b_ first appeared in SCOPe 2.04
  
• d4pv9b_ appears in SCOPe 2.06
  
• d4pv9b_ appears in the current release, SCOPe 2.08