Lineage for d4pera_ (4per A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583822Superfamily c.10.1: RNI-like [52047] (4 families) (S)
    regular structure consisting of similar repeats
  5. 1583882Family c.10.1.0: automated matches [257495] (1 protein)
    not a true family
  6. 1583883Protein automated matches [257496] (1 species)
    not a true protein
  7. 1583884Species Gallus gallus [TaxId:9031] [257497] (1 PDB entry)
  8. 1583885Domain d4pera_: 4per A: [257498]
    Other proteins in same PDB: d4perb_
    automated match to d3tsre_

Details for d4pera_

PDB Entry: 4per (more details), 1.92 Å

PDB Description: structure of gallus gallus ribonuclease inhibitor complexed with gallus gallus ribonuclease i
PDB Compounds: (A:) ribonuclease inhibitor

SCOPe Domain Sequences for d4pera_:

Sequence, based on SEQRES records: (download)

>d4pera_ c.10.1.0 (A:) automated matches {Gallus gallus [TaxId: 9031]}
yfqgmdldiqceeinpsrwaellstmkscstirlddcnlsssnckdlssiihtnpslkel
klnnnelgdagieylckglltpscslqklwlqncnltsascetlrsvlsaqpsltelhvg
dnklgtagvkvlcqglmnpncklqklqleyceltadivealnaalqakptlkelslsnnt
lgdtavkqlcrglveascdlellhlencgitsdscrdisavlsskpslldlavgdnkigd
tglallcqgllhpnckiqklwlwdcdltsasckdlsrvfstketllevslidnnlrdsgm
emlcqalkdpkahlqelwvrecgltaacckavssvlsvnkhlqvlhigenklgnagveil
cegllhpncnihslwlgncditaaccatlanvmvtkqnlteldlsyntledegvmklcea
vrnpnckmqqlilydifwgpevddelkaleearpdvkiis

Sequence, based on observed residues (ATOM records): (download)

>d4pera_ c.10.1.0 (A:) automated matches {Gallus gallus [TaxId: 9031]}
yfqgmdldiqceeinpsrwaellstmkscstirlddcnlsssnckdlssiihtnpslkel
klnnnelgdagieylckglltpslqklwlqncnltsascetlrsvlsaqpsltelhvgdn
klgtagvkvlcqglmnpncklqklqleyceltadivealnaalqakptlkelslsnntlg
dtavkqlcrglveascdlellhlencgitsdscrdisavlsskpslldlavgdnkigdtg
lallcqgllhpnckiqklwlwdcdltsasckdlsrvfstketllevslidnnlrdsgmem
lcqalkdpkahlqelwvrecgltaacckavssvlsvnkhlqvlhigenklgnagveilce
gllhpncnihslwlgncditaaccatlanvmvtkqnlteldlsyntledegvmklceavr
npnckmqqlilydifwgpevddelkaleearpdvkiis

SCOPe Domain Coordinates for d4pera_:

Click to download the PDB-style file with coordinates for d4pera_.
(The format of our PDB-style files is described here.)

Timeline for d4pera_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4perb_