SCOPe 2.04: Domain d4pdca_: 4pdc A:

Lineage for d4pdca_ (4pdc A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)

8. Domain d4pdca_: 4pdc A: [257483]
   automated match to d1hyrb_

Details for d4pdca_

PDB Entry: 4pdc, 1.99 Å

PDB Description: crystal structure of cowpox virus cpxv018 (omcp) bound to human nkg2d

PDB Compounds: (A:) nkg2-d type II integral membrane protein

SCOPe Domain Sequences for d4pdca_:

Sequence; same for both SEQRES and ATOM records:

>d4pdca_ d.169.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
qrt

Timeline for d4pdca_:

• d4pdca_ is new in SCOPe 2.04-stable
  
• d4pdca_ appears in SCOPe 2.05
  
• d4pdca_ appears in the current release, SCOPe 2.08