Lineage for d4pd4f_ (4pd4 F:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255712Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2255713Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2255714Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2255715Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 2255716Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81528] (6 PDB entries)
  8. 2255723Domain d4pd4f_: 4pd4 F: [257479]
    Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
    automated match to d1kb9f_
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4f_

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (F:) Cytochrome b-c1 complex subunit 6

SCOPe Domain Sequences for d4pd4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4f_ f.28.1.1 (F:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

SCOPe Domain Coordinates for d4pd4f_:

Click to download the PDB-style file with coordinates for d4pd4f_.
(The format of our PDB-style files is described here.)

Timeline for d4pd4f_: