Lineage for d4pd4e2 (4pd4 E:87-215)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391958Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2391959Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2391960Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2392045Protein automated matches [190874] (7 species)
    not a true protein
  7. 2392046Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257477] (2 PDB entries)
  8. 2392049Domain d4pd4e2: 4pd4 E:87-215 [257478]
    Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
    automated match to d3cx5e1
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4e2

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d4pd4e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4e2 b.33.1.1 (E:87-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

SCOPe Domain Coordinates for d4pd4e2:

Click to download the PDB-style file with coordinates for d4pd4e2.
(The format of our PDB-style files is described here.)

Timeline for d4pd4e2: