Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
Protein automated matches [254432] (4 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [257475] (1 PDB entry) |
Domain d4pd4e1: 4pd4 E:31-86 [257476] Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_ automated match to d3cx5e2 complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6 |
PDB Entry: 4pd4 (more details), 3.04 Å
SCOPe Domain Sequences for d4pd4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pd4e1 f.23.12.0 (E:31-86) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata
Timeline for d4pd4e1: