SCOPe 2.06: Domain d4pd4d2: 4pd4 D:261-309

Lineage for d4pd4d2 (4pd4 D:261-309)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.0: automated matches [232790] (1 protein)
   not a true family

6. Protein automated matches [232791] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257473] (1 PDB entry)

8. Domain d4pd4d2: 4pd4 D:261-309 [257474]
   Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
   automated match to d2ibzd2
   complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4d2

PDB Entry: 4pd4, 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d4pd4d2:

Sequence; same for both SEQRES and ATOM records:

>d4pd4d2 f.23.11.0 (D:261-309) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkprk

Timeline for d4pd4d2:

• d4pd4d2 first appeared in SCOPe 2.04
  
• d4pd4d2 appears in SCOPe 2.05
  
• d4pd4d2 appears in SCOPe 2.07
  
• d4pd4d2 appears in the current release, SCOPe 2.08