| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
| Family f.23.11.0: automated matches [232790] (1 protein) not a true family |
| Protein automated matches [232791] (3 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:559292] [257473] (1 PDB entry) |
| Domain d4pd4d2: 4pd4 D:261-309 [257474] Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4g_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_ automated match to d2ibzd2 complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6 |
PDB Entry: 4pd4 (more details), 3.04 Å
SCOPe Domain Sequences for d4pd4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pd4d2 f.23.11.0 (D:261-309) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkprk
Timeline for d4pd4d2: