SCOP 1.69: Domain d1g7ca2: 1g7c A:335-443

Lineage for d1g7ca2 (1g7c A:335-443)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins)

6. Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (4 PDB entries)

8. Domain d1g7ca2: 1g7c A:335-443 [25746]
   Other proteins in same PDB: d1g7ca1, d1g7ca3, d1g7cb_

Details for d1g7ca2

PDB Entry: 1g7c, 2.05 Å

PDB Description: yeast eef1a:eef1ba in complex with gdpnp

SCOP Domain Sequences for d1g7ca2:

Sequence; same for both SEQRES and ATOM records:

>d1g7ca2 b.44.1.1 (A:335-443) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdkte

Timeline for d1g7ca2:

• d1g7ca2 first appeared (with stable ids) in SCOP 1.55
  
• d1g7ca2 appears in SCOP 1.67
  
• d1g7ca2 appears in SCOP 1.71
  
• d1g7ca2 appears in the current release, SCOPe 2.08