SCOPe 2.06: Domain d4pcaa1: 4pca A:1-218

Lineage for d4pcaa1 (4pca A:1-218)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (64 species)
   not a true protein

7. Species Anaplasma phagocytophilum [TaxId:1217107] [257458] (2 PDB entries)

8. Domain d4pcaa1: 4pca A:1-218 [257459]
   Other proteins in same PDB: d4pcaa2, d4pcab2, d4pcac2, d4pcad2
   automated match to d4oa8a_
   complexed with edo, mn, sah

Details for d4pcaa1

PDB Entry: 4pca, 1.5 Å

PDB Description: x-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah and manganese

PDB Compounds: (A:) O-methyltransferase family protein

SCOPe Domain Sequences for d4pcaa1:

Sequence; same for both SEQRES and ATOM records:

>d4pcaa1 c.66.1.0 (A:1-218) automated matches {Anaplasma phagocytophilum [TaxId: 1217107]}
mrnvslskqdeylnklfavdtegalkahktapselrmaqlgtvegqmlqllirmagihsi
vevgtcvgfsaicmahalpskghiytiekdyenvvtanqnivnckledkitvlhgealaq
lntlkemapfdmifidankssylaylnwakmyirkgglivadntflfgsvfdehptekvs
snahasmrafndelankekylstiiptsegmmvsiklt

Timeline for d4pcaa1:

• d4pcaa1 first appeared in SCOPe 2.04, called d4pcaa_
  
• d4pcaa1 was called d4pcaa_ in SCOPe 2.05
  
• d4pcaa1 appears in SCOPe 2.07
  
• d4pcaa1 appears in the current release, SCOPe 2.08