SCOP 1.69: Domain d1f60a2: 1f60 A:335-441

Lineage for d1f60a2 (1f60 A:335-441)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins)

6. Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (4 PDB entries)

8. Domain d1f60a2: 1f60 A:335-441 [25745]
   Other proteins in same PDB: d1f60a1, d1f60a3, d1f60b_

Details for d1f60a2

PDB Entry: 1f60, 1.67 Å

PDB Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba

SCOP Domain Sequences for d1f60a2:

Sequence; same for both SEQRES and ATOM records:

>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks
gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdk

Timeline for d1f60a2:

• d1f60a2 first appeared (with stable ids) in SCOP 1.55
  
• d1f60a2 appears in SCOP 1.67
  
• d1f60a2 appears in SCOP 1.71
  
• d1f60a2 appears in the current release, SCOPe 2.08