SCOPe 2.08: Domain d4p8ba_: 4p8b A:

Lineage for d4p8ba_ (4p8b A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Cupriavidus necator [TaxId:381666] [257446] (1 PDB entry)

8. Domain d4p8ba_: 4p8b A: [257447]
   automated match to d4ovsa_
   complexed with cl, x2x

Details for d4p8ba_

PDB Entry: 4p8b, 1.3 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate)

PDB Compounds: (A:) TRAP-type transporter, periplasmic component

SCOPe Domain Sequences for d4p8ba_:

Sequence; same for both SEQRES and ATOM records:

>d4p8ba_ c.94.1.0 (A:) automated matches {Cupriavidus necator [TaxId: 381666]}
ykseykmslvlgpafpwgkggeiwadlvkqrtngriniklypgtslvagdqtrefsairq
gvidmavgstinwspqvrelnlfslpflmpdykaldaltqgevgksifatlekagvvpla
wgengfrevsnskreirkpedlkgmklrvvgsplyietfnalganptqmswadaqpamas
gavdgqenpqsvfaaaklytvgqkfvttwgyvadplifvvnkqiweswtpadreivkqaa
vdagkqeialarkglaepgapawkdmeahgvkvthltpaehdafrkatakvydkwkkqig
tdlvtkaegaiakr

Timeline for d4p8ba_:

• d4p8ba_ first appeared in SCOPe 2.04
  
• d4p8ba_ appears in SCOPe 2.07