Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Cupriavidus necator [TaxId:381666] [257446] (1 PDB entry) |
Domain d4p8ba_: 4p8b A: [257447] automated match to d4ovsa_ complexed with cl, x2x |
PDB Entry: 4p8b (more details), 1.3 Å
SCOPe Domain Sequences for d4p8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p8ba_ c.94.1.0 (A:) automated matches {Cupriavidus necator [TaxId: 381666]} ykseykmslvlgpafpwgkggeiwadlvkqrtngriniklypgtslvagdqtrefsairq gvidmavgstinwspqvrelnlfslpflmpdykaldaltqgevgksifatlekagvvpla wgengfrevsnskreirkpedlkgmklrvvgsplyietfnalganptqmswadaqpamas gavdgqenpqsvfaaaklytvgqkfvttwgyvadplifvvnkqiweswtpadreivkqaa vdagkqeialarkglaepgapawkdmeahgvkvthltpaehdafrkatakvydkwkkqig tdlvtkaegaiakr
Timeline for d4p8ba_: